Structure of PDB 1b2o Chain B |
>1b2oB (length=54) Species: 1501 (Clostridium pasteurianum) [Search protein sequence] |
MKKYTCTVCVYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFE EVEE |
|
PDB | 1b2o Rubredoxin from Clostridium pasteurianum. Structures of G10A, G43A and G10VG43A mutant proteins. Mutation of conserved glycine 10 to valine causes the 9-10 peptide link to invert. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
B |
C6 C9 C39 C42 |
C6 C9 C39 C42 |
|
|
|
|