Structure of PDB 1b0v Chain B

Receptor sequence

>1b0vB (length=106) Species: 354 (Azotobacter vinelandii)

AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECNDCALCEPECP
AQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGK
LQHLER

3D structure

• PDB: 1b0v Alteration of the reduction potential of the [4Fe-4S](2+/+) cluster of Azotobacter vinelandii ferredoxin I.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	F202 C220 C224 F225 I234 C239 N240 C242 A243 C245	F2 C20 C24 F25 I34 C39 N40 C42 A43 C45
BS02	F3S	B	C208 K212 Y213 T214 C216 L232 C249 I254	C8 K12 Y13 T14 C16 L32 C49 I54

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:1b0v, PDBe:1b0v, PDBj:1b0v
• PDBsum: 1b0v
• PubMed: 10593945
• UniProt: P00214|FER1_AZOVI Ferredoxin-1 (Gene Name=fdxA)