Structure of PDB 1b01 Chain B

Receptor sequence
>1b01B (length=43) Species: 1311 (Streptococcus agalactiae) [Search protein sequence]
MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ
3D structure
PDB1b01 The structure of plasmid-encoded transcriptional repressor CopG unliganded and bound to its operator.
ChainB
Resolution2.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K2 R4 L5 T6 I7 T8 K28 S29 K2 R4 L5 T6 I7 T8 K28 S29
BS02 dna B R4 L5 T6 T8 K28 S29 R4 L5 T6 T8 K28 S29
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1b01, PDBe:1b01, PDBj:1b01
PDBsum1b01
PubMed9857196
UniProtP13920|COPG_STRAG Protein CopG (Gene Name=copG)

[Back to BioLiP]