Structure of PDB 1ayo Chain B |
>1ayoB (length=130) Species: 9913 (Bos taurus) [Search protein sequence] |
EFPFALEVQTLPQTCDGPKAHTSFQISLSVSYIGSRPASNMAIVDVKMVS GFIPLKPTVKMLERSNVSRTEVSNNHVLIYLDKVTNETLTLTFTVLQDIP VRDLKPAIVKVYDYYETDEFAVAEYSAPCS |
|
PDB | 1ayo Crystal structure of the receptor-binding domain of alpha 2-macroglobulin. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D120 E121 |
D118 E119 |
|
|
|
|