Structure of PDB 1awp Chain B |
>1awpB (length=86) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
DPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEELLLEQA GADATESFEDLGHSPDAREMLKQYYIGDVHPNDLKP |
|
PDB | 1awp The reduction potential of cytochrome b5 is modulated by its exposed heme edge. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H39 G62 |
Catalytic site (residue number reindexed from 1) |
H39 G62 |
Enzyme Commision number |
? |
|
|
|
|