Structure of PDB 1avd Chain B

Receptor sequence

>1avdB (length=124) Species: 9031 (Gallus gallus)

RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHG
TENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRS
SVNDIGDDWKATRVGINIFTRLRT

3D structure

• PDB: 1avd Three-dimensional structure of the tetragonal crystal form of egg-white avidin in its functional complex with biotin at 2.7 A resolution.
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BTN	B	S16 T35 V37 T38 A39 W70 F72 T77 W97	S15 T34 V36 T37 A38 W69 F71 T76 W96

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

Biological Process

• GO:0019731 antibacterial humoral response

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1avd, PDBe:1avd, PDBj:1avd
• PDBsum: 1avd
• PubMed: 8515446
• UniProt: P02701|AVID_CHICK Avidin (Gene Name=AVD)