Structure of PDB 1av5 Chain B

Receptor sequence

>1av5B (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]

GGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQI
SVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHL
HVLGGRQMHWPPG

3D structure

PDB

1av5 Structure-based analysis of catalysis and substrate definition in the HIT protein family.

Chain

Resolution

2.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

3.4.22.-
3.9.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AP2	B	F19 F41 D43 I44 S45 L53 N99 G105 Q106 S107 V108 H112 H114	F6 F28 D30 I31 S32 L40 N86 G92 Q93 S94 V95 H99 H101

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003824	catalytic activity
GO:0005080	protein kinase C binding
GO:0005515	protein binding
GO:0008234	cysteine-type peptidase activity
GO:0016787	hydrolase activity
GO:0016929	deSUMOylase activity
GO:0043530	adenosine 5'-monophosphoramidase activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006508	proteolysis
GO:0006915	apoptotic process
GO:0007165	signal transduction
GO:0009154	purine ribonucleotide catabolic process
GO:0016926	protein desumoylation
GO:0050850	positive regulation of calcium-mediated signaling
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator

	Cellular Component
GO:0000118	histone deacetylase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0070062	extracellular exosome

External links

PDB	RCSB:1av5, PDBe:1av5, PDBj:1av5
PDBsum	1av5
PubMed	9323207
UniProt	P49773\|HINT1_HUMAN Adenosine 5'-monophosphoramidase HINT1 (Gene Name=HINT1)