Structure of PDB 1au7 Chain B

Receptor sequence
>1au7B (length=128) Species: 10116 (Rattus norvegicus) [Search protein sequence]
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQ
LSFKNACKLKAILSKWLEEAKRRTTISIAAKDALERHFGEHSKPSSQEIM
RMAEELNLEKEVVRVWFCNRRQREKRVK
3D structure
PDB1au7 Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B F42 S43 T45 T46 R49 S56 N59 K103 R105 T106 I108 K113 N151 F38 S39 T41 T42 R45 S52 N55 K71 R73 T74 I76 K81 N119
BS02 dna B R20 T26 Q27 Q44 T45 C48 N52 R105 S128 R146 C150 R153 Q154 K157 R16 T22 Q23 Q40 T41 C44 N48 R73 S96 R114 C118 R121 Q122 K125
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1au7, PDBe:1au7, PDBj:1au7
PDBsum1au7
PubMed9009203
UniProtP10037|PIT1_RAT Pituitary-specific positive transcription factor 1 (Gene Name=Pou1f1)

[Back to BioLiP]