Structure of PDB 1alw Chain B

Receptor sequence
>1alwB (length=173) Species: 9823 (Sus scrofa) [Search protein sequence]
EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCR
SMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELP
GAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKS
LDKDGTGQIQVNIQEWLQLTMYS
3D structure
PDB1alw Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.
ChainB
Resolution2.03 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) F162 G185 I187
Catalytic site (residue number reindexed from 1) F69 G92 I94
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA B A107 D110 E112 E117 A14 D17 E19 E24
BS02 CA B D150 D152 T154 K156 E161 D57 D59 T61 K63 E68
BS03 CA B D180 D182 S184 T186 E191 D87 D89 S91 T93 E98
BS04 CA B D135 D223 D225 N226 D42 D130 D132 N133
BS05 ISA B V125 H129 Q173 F224 V32 H36 Q80 F131 MOAD: Ki=0.3uM
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1alw, PDBe:1alw, PDBj:1alw
PDBsum1alw
PubMed9228946
UniProtP04574|CPNS1_PIG Calpain small subunit 1 (Gene Name=CAPNS1)

[Back to BioLiP]