Structure of PDB 1aid Chain B |
>1aidB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGI GGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 1aid Structure of a non-peptide inhibitor complexed with HIV-1 protease. Developing a cycle of structure-based drug design. |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
THK |
B |
I47 I50 T80 |
I47 I50 T80 |
MOAD: Ki=15uM PDBbind-CN: -logKd/Ki=4.82,Ki=15uM |
|
|
|