Structure of PDB 1ag0 Chain B |
>1ag0B (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFDTFPGHSALMKGTLTLK |
|
PDB | 1ag0 Role of the Active-Site Cysteine of Pseudomonas Aeruginosa Azurin. Crystal Structure Analysis of the Cu(II) Cys112Asp Protein |
Chain | B |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
G46 H47 D113 H118 |
G45 H46 D112 H117 |
|
|
|
|