Structure of PDB 1a8v Chain B |
>1a8vB (length=116) Species: 562 (Escherichia coli) [Search protein sequence] |
GHMNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGED IFGDGVLEILQDGFGFLRSADAGPDDIYVSPSQIRRFNLRTGDTISGKIR PPKEGERYFALLKVNE |
|
PDB | 1a8v The structural basis for terminator recognition by the Rho transcription termination factor. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
G-1 H0 |
G1 H2 |
|
|
|
|