Structure of PDB 1a8k Chain B |
>1a8kB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 1a8k Crystallographic analysis of human immunodeficiency virus 1 protease with an analog of the conserved CA-p2 substrate -- interactions with frequently occurring glutamic acid residue at P2' position of substrates. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
|
|
|
|