Structure of PDB 1a6y Chain B

Receptor sequence

>1a6yB (length=84) Species: 9606 (Homo sapiens)

GMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCS
IVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPK

3D structure

• PDB: 1a6y Structural elements of an orphan nuclear receptor-DNA complex.
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	F111 H112 Y113 K122 R126 R168 V171 R172 F173 R175 I176	F16 H17 Y18 K27 R31 R74 V77 R78 F79 R81 I82
BS02	dna	B	E119 G120 F124 R127 R150 N151 Q154 R157 F173 G174 K178	E24 G25 F29 R32 R56 N57 Q60 R63 F79 G80 K84
BS03	ZN	B	C101 C104 C118 C121	C6 C9 C23 C26
BS04	ZN	B	C137 C143 C153 C156	C43 C49 C59 C62

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:1a6y, PDBe:1a6y, PDBj:1a6y
• PDBsum: 1a6y
• PubMed: 9660968
• UniProt: P20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)