Structure of PDB 1a6b Chain B |
>1a6bB (length=40) Species: 928306 (Moloney murine leukemia virus isolate Shinnick) [Search protein sequence] |
GERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQT |
|
PDB | 1a6b NMR structure of the complex between the zinc finger protein NCp10 of Moloney murine leukemia virus and the single-stranded pentanucleotide d(ACGCC): comparison with HIV-NCp7 complexes. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|