Structure of PDB 1a4g Chain B

Receptor sequence

>1a4gB (length=390) Species: 11525 (Influenza B virus (STRAIN B/BEIJING/1/87))

EPEWTYPRLSCQGSTFQKALLISPHRFGEARGNSAPLIIREPFIACGPKE
CKHFALTHYAAQPGGYYNGTREDRNKLRHLISVKLGKIPTVENSIFHMAA
WSGSACHDGREWTYIGVDGPDSNALIKIKYGEAYTDTYHSYANNILRTQE
SACNCIGGDCYLMITDGSASGISKCRFLKIREGRIIKEIFPTGRVEHTEE
CTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTETYLDTP
RPDDGSITGPCESNGDKGRGGIKGGFVHQRMASKIGRWYSRTMSKTERMG
MELYVRYDGDPWTDSDALAHSGVMVSMKEPGWYSFGFEIKDKKCDVPCIG
IEMVHDGGKKTWHSAATAIYCLMGSGQLLWDTVTGVDMAL

3D structure

• PDB: 1a4g Dihydropyrancarboxamides related to zanamivir: a new series of inhibitors of influenza virus sialidases. 2. Crystallographic and molecular modeling study of complexes of 4-amino-4H-pyran-6-carboxamides and sialidase from influenza virus types A and B.
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D148 E275 R291 R373 Y408
• Catalytic site (residue number reindexed from 1): D73 E200 R216 R298 Y333
• Enzyme Commision number: 3.2.1.18: exo-alpha-sialidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	D292 T296 D323 G343 G345	D217 T221 D248 G268 G270
BS02	ZMR	B	R115 E116 D148 R149 W176 R222 E225 A244 E274 R291 N293 R373 Y408	R40 E41 D73 R74 W101 R147 E150 A169 E199 R216 N218 R298 Y333	MOAD: ic50=0.004uM

Gene Ontology

Molecular Function

• GO:0004308 exo-alpha-sialidase activity

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0046761 viral budding from plasma membrane

Cellular Component

• GO:0016020 membrane
• GO:0033644 host cell membrane
• GO:0055036 virion membrane

External links

• PDB: RCSB:1a4g, PDBe:1a4g, PDBj:1a4g
• PDBsum: 1a4g
• PubMed: 9526556
• UniProt: P27907|NRAM_INBBE Neuraminidase (Gene Name=NA)