Structure of PDB 1a4f Chain B

Receptor sequence
>1a4fB (length=146) Species: 8846 (Anser indicus) [Search protein sequence]
VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSS
PTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDP
ENFRLLGDILIIVLAAHFAKEFTPDCQAAWQKLVRVVAHALARKYH
3D structure
PDB1a4f The crystal structure of a high oxygen affinity species of haemoglobin (bar-headed goose haemoglobin in the oxy form).
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B F41 F42 H63 K66 L88 H92 N102 L106 L141 F41 F42 H63 K66 L88 H92 N102 L106 L141
BS02 OXY B H63 V67 H63 V67
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1a4f, PDBe:1a4f, PDBj:1a4f
PDBsum1a4f
PubMed8568892
UniProtP02118|HBB_ANSIN Hemoglobin subunit beta (Gene Name=HBB)

[Back to BioLiP]