Structure of PDB 1a30 Chain B |
>1a30B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGI GGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 1a30 Hydrophilic peptides derived from the transframe region of Gag-Pol inhibit the HIV-1 protease. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
R8 D25 V82 |
R8 D25 V82 |
|
|
|
|