Structure of PDB 1a1r Chain B

Receptor sequence

>1a1rB (length=179)

PITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGV
CWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGS
SDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAV
GLFRAAVCTRGVAKAVDFIPVENLETTMR

3D structure

• PDB: 1a1r Crystal structure of the hepatitis C virus NS3 protease domain complexed with a synthetic NS4A cofactor peptide.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H83 D107 G163 S165
• Catalytic site (residue number reindexed from 1): H56 D80 G136 S138
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	A31 Y32 A33	A4 Y5 A6
BS02	peptide	B	T30 A31 Y32 A33 Q34 Q35 T36 R37 C42 T45 S46 E56 E58 V59 I61 V62 S63 R88 T89 I90 A91	T3 A4 Y5 A6 Q7 Q8 T9 R10 C15 T18 S19 E29 E31 V32 I34 V35 S36 R61 T62 I63 A64
BS03	ZN	B	C123 C125 C171	C96 C98 C144

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:1a1r, PDBe:1a1r, PDBj:1a1r
• PDBsum: 1a1r
• PubMed: 8861917
• UniProt: P27958|POLG_HCV77 Genome polyprotein