Structure of PDB 8ove Chain Az

Receptor sequence
>8oveAz (length=43) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
PIFRTSTTNGQIRELLRIRTYRQNYNGTEFRGKKRVALSTRSL
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainAz
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Az S167 T169 N170 Q190 N191 R216 K218 R221 T226 S6 T8 N9 Q23 N24 R31 K33 R35 T40
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtQ382D5

[Back to BioLiP]