Structure of PDB 7o7z Chain Ay

Receptor sequence
>7o7zAy (length=85) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
KKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIR
GSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKG
3D structure
PDB7o7z Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.
ChainAy
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ay K32 K34 W35 R41 K43 L44 N46 R80 G81 S82 R85 K102 H103 R104 K2 K4 W5 R11 K13 L14 N16 R50 G51 S52 R55 K72 H73 R74
BS02 rna Ay K33 W35 K3 W5
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006364 rRNA processing
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o7z, PDBe:7o7z, PDBj:7o7z
PDBsum7o7z
PubMed34029205
UniProtG1TDB3|RS25_RABIT Small ribosomal subunit protein eS25 (Gene Name=RPS25)

[Back to BioLiP]