Structure of PDB 7ane Chain Ay

Receptor sequence
>7aneAy (length=142) Species: 5664 (Leishmania major) [Search protein sequence]
SKWIDRRSTRVPHNGKDIWYFGDQPSCALCHIRFRYKQDYEAHKESELHV
NRLRWVETMNWWRETGEPAYLKASNEQWEWFEQHVLPTKAQEMGCTLDEA
RRVYRQAIMTETPTWHRPLQCPTVKQEVQEPRDQRWPASPKW
3D structure
PDB7ane Structure of the mature kinetoplastids mitoribosome and insights into its large subunit biogenesis.
ChainAy
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ay R39 T41 R7 T9
BS02 rna Ay K34 W35 I36 D37 R38 R39 S40 R42 P44 H45 N46 K48 Y52 Q56 I64 R65 F66 R67 Y68 D71 R164 R167 P172 K173 K2 W3 I4 D5 R6 R7 S8 R10 P12 H13 N14 K16 Y20 Q24 I32 R33 F34 R35 Y36 D39 R132 R135 P140 K141
External links