Structure of PDB 6skf Chain Ax

Receptor sequence
>6skfAx (length=61) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
PKNLIPMPRSRFLRVKCIDCGNEQIVFSHPATPVRCLVCGATLVEPTGGK
GIIKAKVLEVE
3D structure
PDB6skf Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainAx
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ax P11 R12 S13 A34 T50 G51 K53 P8 R9 S10 A31 T47 G48 K50
BS02 ZN Ax C20 C23 C39 C42 C17 C20 C36 C39
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skf, PDBe:6skf, PDBj:6skf
PDBsum6skf
PubMed32555463
UniProtQ5JE50|RS27_THEKO Small ribosomal subunit protein eS27 (Gene Name=rps27e)

[Back to BioLiP]