Structure of PDB 4ujd Chain Au

Receptor sequence
>4ujdAu (length=210) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
ADQEIENAVSRALEDAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLP
AGTGQETTIVVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADD
TDFFIAEKGLMQDIGRYLGTVLGPRGKMPEPLDPDDDVVEVIERMKNTVQ
LRSGERRTFHTRVGAEDMSAENIADNIDVILRRLHADLEKGPLNIDTVYV
KTTMGPAMEV
3D structure
PDB4ujd Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires
ChainAu
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Au R19 N20 F21 A28 V29 N30 Q55 D92 K95 D99 P124 R152 E155 R156 T158 H160 T161 R162 D196 Y199 K201 M204 A207 R19 N20 F21 A28 V29 N30 Q55 D92 K95 D99 P124 R152 E155 R156 T158 H160 T161 R162 D196 Y199 K201 M204 A207
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Mar 7 09:07:37 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujd', asym_id = 'Au', title = 'Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujd', asym_id='Au', title='Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '4ujd', asym_id = 'Au'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='4ujd', asym_id='Au')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>