Structure of PDB 6skg Chain As

Receptor sequence
>6skgAs (length=108) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
REIGLRVQPPAEVCNDPKCPWHGNLKIHGRYVEGIVVSDKGKKTVVVERQ
YYHYLKKYERYELRKSKVHAHNPECINAKVGDKVLIAETRPISKTKSWVV
VAVLQRAE
3D structure
PDB6skg Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainAs
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna As R2 K19 N25 K27 I28 H29 K43 R50 K58 E60 R65 K66 S67 R91 P92 S94 K95 T96 K97 W99 R1 K18 N24 K26 I27 H28 K42 R49 K57 E59 R64 K65 S66 R90 P91 S93 K94 T95 K96 W98
BS02 ZN As C15 C76 C14 C75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skg, PDBe:6skg, PDBj:6skg
PDBsum6skg
PubMed32555463
UniProtQ5JDH9|RS17_THEKO Small ribosomal subunit protein uS17 (Gene Name=rps17)

[Back to BioLiP]