Structure of PDB 8apn Chain Ar

Receptor sequence

>8apnAr (length=155) Species: 353565 (Polytomella magna)

DYLLDDDINGDPSNPLNKPMHFGSFQKQRQPNSFRRLPICFPDIKLTLMK
LEEHQLEQIKQTGWLREAAFKTTPNTTKLEIKAFLESVYGMEVERVNTAN
YLGRKRVVYTGKAKELYREDDYKKAYVIFKKPEGLSLPETRPLLQKLVDI
KLKRK

3D structure

• PDB: 8apn Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
• Chain: Ar
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ar	Q79 E118 K129 N148 T149 Y152 R155 K175 Y177 K213	Q28 E67 K78 N97 T98 Y101 R104 K124 Y126 K155
BS02	rna	Ar	T128 K129 N151	T77 K78 N100
BS03	peptide	Ar	V158 Y160	V107 Y109

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Feb 20 09:52:03 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8apn', asym_id = 'Ar', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8apn', asym_id='Ar', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8apn', asym_id = 'Ar'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8apn', asym_id='Ar')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>