Structure of PDB 6xyw Chain Ar

Receptor sequence
>6xywAr (length=137) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
AEKVEEAEEIGYKVMGPLKPSERLFKPYEPVFAIVQIGSHQFKVSNGDSI
FTEKLKFCDINDKLELTKVLLLGSASQTIIGRPILPDATVHAVVEEHALD
EKVLIFKKKRRKNYRRTRGHRQELTKLRITDIQGIEK
3D structure
PDB6xyw Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
ChainAr
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ar R132 S148 H149 E162 K165 K211 I214 K217 K218 R219 R220 K221 N222 R224 R225 T226 R227 G228 H229 R230 Q231 R23 S39 H40 E53 K56 K102 I105 K108 K109 R110 R111 K112 N113 R115 R116 T117 R118 G119 H120 R121 Q122
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000741 karyogamy
GO:0006412 translation
GO:0009553 embryo sac development
GO:0009555 pollen development
GO:0009567 double fertilization forming a zygote and endosperm
GO:0010197 polar nucleus fusion
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xyw, PDBe:6xyw, PDBj:6xyw
PDBsum6xyw
PubMed32251374
UniProtQ8L9A0|RM21_ARATH Large ribosomal subunit protein bL21m (Gene Name=RPL21M)

[Back to BioLiP]