Structure of PDB 6skf Chain Ar

Receptor sequence
>6skfAr (length=54) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
KADYNKRKPRKFGKGARRCMRCGQYGPIIRIHGLMLCRHCFREVAPKLGF
KKYE
3D structure
PDB6skf Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainAr
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ar K3 Y6 N7 R9 R12 F14 K16 G17 R19 C24 Y27 I31 R32 H34 R40 H41 R44 Y55 E56 K1 Y4 N5 R7 R10 F12 K14 G15 R17 C22 Y25 I29 R30 H32 R38 H39 R42 Y53 E54
BS02 ZN Ar C24 C42 C22 C40
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skf, PDBe:6skf, PDBj:6skf
PDBsum6skf
PubMed32555463
UniProtQ5JJG2|RS14Z_THEKO Small ribosomal subunit protein uS14 (Gene Name=rps14)

[Back to BioLiP]