Structure of PDB 8xjv Chain Aq

Receptor sequence

>8xjvAq (length=190) Species: 9031 (Gallus gallus) [Search protein sequence]

MTESLVLSPAPAKPKRVKASRRSASHPTYSEMIAAAIRAEKSRGGSSRQS
IQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSD
KAKRSPGKKKKAVRRSTSPKKAARPRKARSPAKKPKATARKARKKSRASP
KKAKKPKTVKAKSRKASKAKKVKRSKPRAKSGARKSPKKK

3D structure

PDB

8xjv Structural basis for linker histone H5-nucleosome binding and chromatin fiber compaction.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	Aq	P8 P10 A11 K14 R21 A23 S56 H57 Q83 K85 V87 R103 V112 S115 T116 K119 R123 K159 A168 K169 K172	P9 P11 A12 K15 R22 A24 S57 H58 Q84 K86 V88 R104 V113 S116 T117 K120 R124 K160 A169 K170 K173
BS02	dna	Aq	T1 E2 R15 K17 A18 R20 R21 H57 Y58 K59 V60 G61 H62 G86 V87 K108 K109 K110 K135 A152 K175 K179	T2 E3 R16 K18 A19 R21 R22 H58 Y59 K60 V61 G62 H63 G87 V88 K109 K110 K111 K136 A153 K176 K180

External links

PDB	RCSB:8xjv, PDBe:8xjv, PDBj:8xjv
PDBsum	8xjv
PubMed	39103524
UniProt	P02259\|H5_CHICK Histone H5

[Back to BioLiP]