Structure of PDB 8apo Chain Aq

Receptor sequence

>8apoAq (length=188) Species: 353565 (Polytomella magna)

SRPPLYARSGKFRESEEVQPYRTWYWYDAETESEERRKELRQQLYRDSGM
SYYLNIPQSMKKLERVVRVIRNLAYDEAWKQACVLPLKAAGFVKEGLEHA
RKDAEEKGLDPKKLVVSTVYTAKGKYLRGFQPMGKGFAGRKTTRKTHLRI
VLRENASVLPFAAQVVSPSRVGGASQKHLRDISVRYTV

3D structure

• PDB: 8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
• Chain: Aq
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Aq	R75 Y119 M127 R138 Y187 K190 R216	R8 Y52 M60 R71 Y120 K123 R149
BS02	rna	Aq	G201 K202 F204	G134 K135 F137
BS03	rna	Aq	S126 K128 R207 R211	S59 K61 R140 R144
BS04	rna	Aq	Q125 K129 K155 Q198 P199 M200 G203 F204 R207 K208 T209	Q58 K62 K88 Q131 P132 M133 G136 F137 R140 K141 T142
BS05	rna	Aq	Q243 K244 L246 R247 R252 Y253	Q176 K177 L179 R180 R185 Y186
BS06	peptide	Aq	S118 Y119 Y120 L121 N122 H166	S51 Y52 Y53 L54 N55 H99

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 00:24:43 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8apo', asym_id = 'Aq', title = 'Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8apo', asym_id='Aq', title='Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '8apo', asym_id = 'Aq'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='8apo', asym_id='Aq')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>