Structure of PDB 8apo Chain Ap

Receptor sequence

>8apoAp (length=200) Species: 353565 (Polytomella magna)

VRTKLPSKRPFLQTASHLAVNSLVPSVRTNRWADLIKGPAVRSCIPEIPE
VPKPSEYTTIGTIEGPYTLNLERVFGVVELAGSQYKVTPDDVIFTNLLHG
IEVNEVVMLERVMLLGSRSNTIIGRPYIPGACVLAAVEEHFLDGTVHVFK
RKKRKRYRRYKPTRPMMTTLRILKVLGIDPAPGDELGIPSGPVIKITNTE

3D structure

• PDB: 8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
• Chain: Ap
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ap	R151 K153 R154	R151 K153 R154
BS02	rna	Ap	R2 K4 H17 N21	R2 K4 H17 N21
BS03	rna	Ap	K150 K155	K150 K155
BS04	rna	Ap	N96 H99	N96 H99
BS05	rna	Ap	R156 Y157	R156 Y157
BS06	rna	Ap	V1 R2 T3 L5	V1 R2 T3 L5

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 00:21:42 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8apo', asym_id = 'Ap', title = 'Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8apo', asym_id='Ap', title='Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '8apo', asym_id = 'Ap'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='8apo', asym_id='Ap')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>