Structure of PDB 6th6 Chain Ap

Receptor sequence
>6th6Ap (length=135) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence]
NFRHIVRVAGVDIDGHKQVRWALTGIKGIGINFATMVLRVAGIDPFMKAG
YLTDEQVKKIEEILADPVAHGIPAWAVNRPKDYETGKDMHLITAKLVMAW
REDVNRLRRIRAYRGIRHELGLPVRGQRTRSNFRH
3D structure
PDB6th6 Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainAp
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ap W24 K30 G31 I32 G33 F36 F49 W78 A79 V80 N81 P83 K84 Y116 R117 R120 H121 V127 R128 Q130 R131 T132 R133 S134 N135 F136 R137 W21 K27 G28 I29 G30 F33 F46 W75 A76 V77 N78 P80 K81 Y113 R114 R117 H118 V124 R125 Q127 R128 T129 R130 S131 N132 F133 R134
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6th6, PDBe:6th6, PDBj:6th6
PDBsum6th6
PubMed32555463
UniProtQ5JJF1|RS13_THEKO Small ribosomal subunit protein uS13 (Gene Name=rps13)

[Back to BioLiP]