Structure of PDB 6skg Chain Ap

Receptor sequence
>6skgAp (length=135) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]
NFRHIVRVAGVDIDGHKQVRWALTGIKGIGINFATMVLRVAGIDPFMKAG
YLTDEQVKKIEEILADPVAHGIPAWAVNRPKDYETGKDMHLITAKLVMAW
REDVNRLRRIRAYRGIRHELGLPVRGQRTRSNFRH
3D structure
PDB6skg Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.
ChainAp
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ap W24 K30 G31 G33 F36 W78 N81 P83 R117 R120 H121 P126 V127 R128 Q130 R131 T132 R133 S134 F136 R137 H138 W21 K27 G28 G30 F33 W75 N78 P80 R114 R117 H118 P123 V124 R125 Q127 R128 T129 R130 S131 F133 R134 H135
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6skg, PDBe:6skg, PDBj:6skg
PDBsum6skg
PubMed32555463
UniProtQ5JJF1|RS13_THEKO Small ribosomal subunit protein uS13 (Gene Name=rps13)

[Back to BioLiP]