Structure of PDB 6hiv Chain Ap

Receptor sequence

>6hivAp (length=261) Species: 5702 (Trypanosoma brucei brucei)

NLKGLVYPLPYYAMWRGNHNKYTYNKSTVCLWGEGDTRSMYHQHYAHAKC
PTDYGRGGREFEYLTVKRGKMLQKPLPRVQYVAEGSKPVWLFKSWHTPLS
SPSMWEREVQYAEHTPEHIGAKRPLAVVAPRTMHRYLFLMHMEKVTITVS
PLLFGYGHTIQKAVLDFYRRAISARSPFPKDKVFLFYAIDHITPRIEVTW
LDGTSYVPPVLEGASSQDLIQMVMEEAWLAADRMAAEGRVLNPLAIDDYK
WDQLVVFKKVR

3D structure

• PDB: 6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
• Chain: Ap
• Resolution: 7.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ap	K39 K57 Y58 R171 Y172 R206 S209 R211 Q253 K294 V296 R297	K3 K21 Y22 R135 Y136 R170 S173 R175 Q217 K258 V260 R261
BS02	peptide	Ap	M140 W141 P166 R167 K286 W287 Q289 L290 V291	M104 W105 P130 R131 K250 W251 Q253 L254 V255
BS03	peptide	Ap	K123 V125 W126 L127 F128	K87 V89 W90 L91 F92
BS04	peptide	Ap	K123 P124 W126 F128	K87 P88 W90 F92

Gene Ontology

Cellular Component

• GO:0005739 mitochondrion
• GO:0005762 mitochondrial large ribosomal subunit

External links

• PDB: RCSB:6hiv, PDBe:6hiv, PDBj:6hiv
• PDBsum: 6hiv
• PubMed: 30213880
• UniProt: Q57YA9