Structure of PDB 7o81 Chain Ao

Receptor sequence

>7o81Ao (length=128) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

TFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLSRGLRRKQHSLLKRL
RKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPE
MIGHYLGEFSITYKPVKHGRPGIGATHS

3D structure

PDB

7o81 Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ao	R18 S38 A39 R40 R42 R43 R44 R47 R50 R51 R59 K77 H79 R81 D82 Y97 G99 K100 Y115 G117 E118 T122 Y123 K124 V126 H128 G129 R130 G132 A135	R8 S28 A29 R30 R32 R33 R34 R37 R40 R41 R49 K67 H69 R71 D72 Y87 G89 K90 Y105 G107 E108 T112 Y113 K114 V116 H118 G119 R120 G122 A125
BS02	rna	Ao	T136 H137	T126 H127

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000056	ribosomal small subunit export from nucleus
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7o81, PDBe:7o81, PDBj:7o81
PDBsum	7o81
PubMed	34029205
UniProt	G1U0Q2\|RS15_RABIT Small ribosomal subunit protein uS19 (Gene Name=RPS15)