Structure of PDB 7nqh Chain An

Receptor sequence

>7nqhAn (length=72) Species: 9823 (Sus scrofa) [Search protein sequence]

KNILKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLRQKQVKFERDLKRIW
QKAGLKEAPAGWQTPKIYLKNQ

3D structure

PDB

7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	An	K128 N129 I130 L131 K132 I133 R134 R135 R136 K137 M138 N139 H140 H141 K142 Y143 R144 K145 V147 R149 R151 R154 R155 R158 R161 K165 R171 R175 K179 Y195 K197 Q199	K1 N2 I3 L4 K5 I6 R7 R8 R9 K10 M11 N12 H13 H14 K15 Y16 R17 K18 V20 R22 R24 R27 R28 R31 R34 K38 R44 R48 K52 Y68 K70 Q72
BS02	rna	An	R151 F152 E159 R163 Q199	R24 F25 E32 R36 Q72

Gene Ontology

	Biological Process
GO:0045862	positive regulation of proteolysis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0043231	intracellular membrane-bounded organelle

External links