Structure of PDB 6gaz Chain An

Receptor sequence

>6gazAn (length=72) Species: 9823 (Sus scrofa) [Search protein sequence]

KNILKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLRQKQVKFERDLKRIW
QKAGLKEAPAGWQTPKIYLKNQ

3D structure

PDB

6gaz Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	An	K128 N129 L131 K132 I133 R134 R135 R136 K137 M138 N139 H140 H141 K142 Y143 R144 K145 V147 K148 R149 R151 R155 R158 R161 K165 K168 R171 R175 Y195 Q199	K1 N2 L4 K5 I6 R7 R8 R9 K10 M11 N12 H13 H14 K15 Y16 R17 K18 V20 K21 R22 R24 R28 R31 R34 K38 K41 R44 R48 Y68 Q72

Gene Ontology

	Biological Process
GO:0045862	positive regulation of proteolysis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0043231	intracellular membrane-bounded organelle

External links