Structure of PDB 8evs Chain Al

Receptor sequence

>8evsAl (length=50) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

3D structure

PDB

8evs Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Al	A2 A3 Q4 K5 F7 K10 M13 K17 P22 I35 Y37 A39 R41 R42 W44 R45 T47 K48 M49	A1 A2 Q3 K4 F6 K9 M12 K16 P21 I34 Y36 A38 R40 R41 W43 R44 T46 K47 M48
BS02	rna	Al	F7 Q11 K12 K15 K18 Q19 R21 L23 P24 W26 I27 L29 R30 T31 I35 K40	F6 Q10 K11 K14 K17 Q18 R20 L22 P23 W25 I26 L28 R29 T30 I34 K39

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum	8evs
PubMed	37595043
UniProt	P04650\|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)