Structure of PDB 7n8b Chain Al

Receptor sequence

>7n8bAl (length=50) Species: 4932 (Saccharomyces cerevisiae)

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

3D structure

• PDB: 7n8b CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Chain: Al
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Al	A2 A3 Q4 K5 F7 K10 M13 K17 P22 I35 Y37 A39 R41 R42 W44 R45 K48 M49	A1 A2 Q3 K4 F6 K9 M12 K16 P21 I34 Y36 A38 R40 R41 W43 R44 K47 M48
BS02	rna	Al	F7 R8 Q11 K12 K15 K18 Q19 R21 L23 P24 W26 I27 L29 R30 T31 I35 K40	F6 R7 Q10 K11 K14 K17 Q18 R20 L22 P23 W25 I26 L28 R29 T30 I34 K39

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7n8b, PDBe:7n8b, PDBj:7n8b
• PDBsum: 7n8b
• PubMed: 35489333
• UniProt: P04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)