Structure of PDB 7mpj Chain Aj

Receptor sequence

>7mpjAj (length=87) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

PDB

7mpj CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	Aj	G2 K3 G4 T5 P6 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 K31 S35 S36 K43 T44 R45 Y47 N48 W49 K52 R55 R56	G1 K2 G3 T4 P5 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 K30 S34 S35 K42 T43 R44 Y46 N47 W48 K51 R54 R55
BS02	rna	Aj	T17 N20 R21 C22 G23 V29 T59 G60 T61 G62 R63 M64 R65 Y66 L67 K68 V70 S71 R72 F74 N76 Q79 G81 S82 A83 K85 A86 S87 A88	T16 N19 R20 C21 G22 V28 T58 G59 T60 G61 R62 M63 R64 Y65 L66 K67 V69 S70 R71 F73 N75 Q78 G80 S81 A82 K84 A85 S86 A87
BS03	MG	Aj	A42 K43 T44	A41 K42 T43
BS04	MG	Aj	G2 K3 G4 P6	G1 K2 G3 P5
BS05	MG	Aj	A53 R56	A52 R55
BS06	MG	Aj	R24 R25	R23 R24

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7mpj, PDBe:7mpj, PDBj:7mpj
PDBsum	7mpj
PubMed	35489333
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)