Structure of PDB 8evp Chain Ai

Receptor sequence
>8evpAi (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB8evp Regulation of translation by ribosomal RNA pseudouridylation.
ChainAi
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Ai K4 G14 K15 V17 I26 S27 Y28 K29 K30 G31 A33 S34 N35 R36 T37 R41 Y53 R55 R56 D59 N63 R68 R76 G78 F80 R82 K84 K3 G13 K14 V16 I25 S26 Y27 K28 K29 G30 A32 S33 N34 R35 T36 R40 Y52 R54 R55 D58 N62 R67 R75 G77 F79 R81 K83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8evp, PDBe:8evp, PDBj:8evp
PDBsum8evp
PubMed37595043
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]