Structure of PDB 6skf Chain Ai

Receptor sequence

>6skfAi (length=214) Species: 311400 (Thermococcus kodakarensis) [Search protein sequence]

AKPLTERFFIPKEVKVMGRWSVEDVTVEDPSLKPYINLDARILPHSHGRY
AKKPFGKANVHIVERLINKVMRSGASHYKAGGHFMRREHRSIMSKKMKAY
EVVKEAFMIIERRTKQNPIQVLVKAIENSAPREDTTTIAFGGIRYHMSVD
VSPLRRLDIALKNIALGASIKCYRNKTTYAQALAEEIIAAANKDPKSFAY
SKKEEIERIAQSSR

3D structure

PDB

6skf Dynamic RNA acetylation revealed by quantitative cross-evolutionary mapping.

Chain

Resolution

2.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ai	A2 H48 G49 P55 K58 R66 N69 K70 R73 S74 S77 H78 H84 F85 R87 R88 E89 R91 S92 I93 S95 K97 R145 R156 D159 S170 Y174 R175 K177 Y180	A1 H47 G48 P54 K57 R65 N68 K69 R72 S73 S76 H77 H83 F84 R86 R87 E88 R90 S91 I92 S94 K96 R144 R155 D158 S169 Y173 R174 K176 Y179

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6skf, PDBe:6skf, PDBj:6skf
PDBsum	6skf
PubMed	32555463
UniProt	Q5JE04\|RS7_THEKO Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]