Structure of PDB 6gaz Chain Ai

Receptor sequence
>6gazAi (length=99) Species: 9823 (Sus scrofa) [Search protein sequence]
LSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYP
NHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRA
3D structure
PDB6gaz Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
ChainAi
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ai K29 K32 A60 G63 T64 F67 H75 R79 Q82 R89 K91 K93 R95 K96 G97 K100 K26 K29 A57 G60 T61 F64 H72 R76 Q79 R86 K88 K90 R92 K93 G94 K97
BS02 peptide Ai R10 R13 R7 R10
External links