Structure of PDB 8evq Chain Ah

Receptor sequence

>8evqAh (length=119) Species: 4932 (Saccharomyces cerevisiae)

AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA

3D structure

• PDB: 8evq Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: Ah
• Resolution: 2.72 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Ah	G72 Y75 R81 R86 R90 T93 K94 F95 K103 K106 K115	G71 Y74 R80 R85 R89 T92 K93 F94 K102 K105 K114
BS02	rna	Ah	A6 Y7 R10 K35 K45 K49 A52 C53 L55 T56 N59 R63 R67 K78 A82 K83 T85 R86 R89	A5 Y6 R9 K34 K44 K48 A51 C52 L54 T55 N58 R62 R66 K77 A81 K82 T84 R85 R88
BS03	MG	Ah	R48 K49	R47 K48

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8evq, PDBe:8evq, PDBj:8evq
• PDBsum: 8evq
• PubMed: 37595043
• UniProt: P0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)