Structure of PDB 5aj4 Chain Ah |
>5aj4Ah (length=103) Species: 9823 (Sus scrofa) [Search protein sequence] |
PFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFP KQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRVILKESGI QLN |
|
PDB | 5aj4 The complete structure of the 55S mammalian mitochondrial ribosome. |
Chain | Ah |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
Ah |
H321 F325 |
H37 F41 |
|
|
|
|