Structure of PDB 3jbn Chain Ah

Receptor sequence
>3jbnAh (length=85) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
SRRTKKVGLTGKYGTRYGSSLRKQIKKIELMQHAKYLCTFCGKTATKRTC
VGIWKCKKCKRKVCGGAWSLTTPAAVAAKSTIIRL
3D structure
PDB3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
ChainAh
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ah K7 R85 K6 R84
BS02 rna Ah S2 R3 R4 T5 K6 K7 V8 G9 L10 G12 K13 R17 Y18 G19 S20 S21 R23 Q33 H34 F41 C42 K44 K48 R49 T50 C51 V52 K58 K59 R62 W69 S1 R2 R3 T4 K5 K6 V7 G8 L9 G11 K12 R16 Y17 G18 S19 S20 R22 Q32 H33 F40 C41 K43 K47 R48 T49 C50 V51 K57 K58 R61 W68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum3jbn
PubMed26432834
UniProtO96184|RL37A_PLAF7 Large ribosomal subunit protein eL43 (Gene Name=RPL37A)

[Back to BioLiP]