Structure of PDB 4v5z Chain Ag

Receptor sequence
>4v5zAg (length=163) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
IKLFGKWSTDDVQINDISLQDYIAKAQCPIVERLTNSMMMHGRNNGKKLM
TVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQA
VDSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELIAAKGSSSYAIK
KKDELERVAKSNR
3D structure
PDB4v5z Structure of the Mammalian 80S Ribosome at 8.7 A Resolution
ChainAg
Resolution8.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ag M77 M78 N82 N83 K86 M88 R145 N148 W152 A162 F163 M39 M40 N44 N45 K48 M50 R106 N109 W113 A123 F124
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 04:42:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5z', asym_id = 'Ag', title = 'Structure of the Mammalian 80S Ribosome at 8.7 A Resolution'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5z', asym_id='Ag', title='Structure of the Mammalian 80S Ribosome at 8.7 A Resolution')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935', uniprot = '', pdbid = '4v5z', asym_id = 'Ag'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935', uniprot='', pdbid='4v5z', asym_id='Ag')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>