Structure of PDB 3jbp Chain Ag

Receptor sequence
>3jbpAg (length=37) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]
HGASRYKKSRAKMRWKWKKKRTRRLQKKRRKMRQRSR
3D structure
PDB3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.
ChainAg
Resolution6.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Ag H3 S6 R7 Y8 K9 K10 S11 R12 A13 M15 R16 W17 K18 W19 K20 K21 K22 R23 R25 R26 R31 R32 R35 R39 H1 S4 R5 Y6 K7 K8 S9 R10 A11 M13 R14 W15 K16 W17 K18 K19 K20 R21 R23 R24 R29 R30 R33 R37
BS02 rna Ag K33 R37 K31 R35
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum3jbp
PubMed26432834
UniProtC6S3G4

[Back to BioLiP]