Structure of PDB 8rd8 Chain Af

Receptor sequence

>8rd8Af (length=211) Species: 45610 (Psychrobacter urativorans)

AIGLVGKKCGMTRVFTEAGASIPVTVVEISANRITQVKNTDVDGYQAIQV
TTGTRRDSRVTAAQKGHFAKAGVAAGRGVWEFRANDSDLEGREIGGEILA
DLFEQGQMVDVTGNSKGKGFQGGVKRHNFSMQDATHGNSVSHRAIGSTGQ
NQSPGKVFKGKKMPGQMGNKRVTVQGLEVISVDVEKGLLVIKGAIPGATG
GDVIVRPSVKA

3D structure

• PDB: 8rd8 A new family of bacterial ribosome hibernation factors
• Chain: Af
• Resolution: 2.62 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Af	K9 M12 R14 P24 Q37 V43 D44 Y46 Q50 R56 R57 R60 T62 A63 A64 Q65 G67 H68 K71 V80 E82 R84 S116 K117 G118 K119 G120 F121 Q122 G123 R127 N129 F130 S131 M132 Q133 A135 T136 H137 G138 N139 S140 V141 S142 H143 R144 I146 S148 T149 G150 Q151 N152 Q153 S154 P155 G156 K157 V158 F159 K160 G161 K162 M164 P165 Q167 N170 R172 V173 T174 Q176 L178 K193 P197 G198 A199 T200 V210 K211	K8 M11 R13 P23 Q36 V42 D43 Y45 Q49 R55 R56 R59 T61 A62 A63 Q64 G66 H67 K70 V79 E81 R83 S115 K116 G117 K118 G119 F120 Q121 G122 R126 N128 F129 S130 M131 Q132 A134 T135 H136 G137 N138 S139 V140 S141 H142 R143 I145 S147 T148 G149 Q150 N151 Q152 S153 P154 G155 K156 V157 F158 K159 G160 K161 M163 P164 Q166 N169 R171 V172 T173 Q175 L177 K192 P196 G197 A198 T199 V209 K210

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
• PDBsum: 8rd8
• PubMed: 38355796
• UniProt: A0A0M4T1M3