Structure of PDB 8evs Chain Af

Receptor sequence

>8evsAf (length=106) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

3D structure

PDB

8evs Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Af	A2 E3 S4 H5 R6 Y8 K10 Q17 R18 S19 K20 R21 V22 N23 P25 L45 G46 Y53 R54 S56 K57 V59 R60 S62 I64 R65 V66 M67 W68 K70 T72 R73 H75 G76 N77 S78 R82 R86 N87 N88 P90 A91 K92 F94 A96 S97 R99 N106	A1 E2 S3 H4 R5 Y7 K9 Q16 R17 S18 K19 R20 V21 N22 P24 L44 G45 Y52 R53 S55 K56 V58 R59 S61 I63 R64 V65 M66 W67 K69 T71 R72 H74 G75 N76 S77 R81 R85 N86 N87 P89 A90 K91 F93 A95 S96 R98 N105
BS02	MG	Af	Q17 R18 H75	Q16 R17 H74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8evs, PDBe:8evs, PDBj:8evs
PDBsum	8evs
PubMed	37595043
UniProt	P05744\|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)